Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 3213068..3213723 | Replicon | chromosome |
Accession | NZ_OW622535 | ||
Organism | Burkholderia mallei strain 34 isolate 34 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0H2WL39 |
Locus tag | NIU15_RS13975 | Protein ID | WP_004199884.1 |
Coordinates | 3213427..3213723 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q63YL3 |
Locus tag | NIU15_RS13970 | Protein ID | WP_004202809.1 |
Coordinates | 3213068..3213424 (-) | Length | 119 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIU15_RS13940 | 3209200..3209958 | + | 759 | WP_004199892.1 | cytochrome c1 | - |
NIU15_RS13945 | 3210051..3210662 | + | 612 | WP_004185176.1 | glutathione S-transferase N-terminal domain-containing protein | - |
NIU15_RS13950 | 3210732..3211253 | + | 522 | WP_004199890.1 | ClpXP protease specificity-enhancing factor | - |
NIU15_RS13960 | 3211535..3211972 | + | 438 | WP_004557287.1 | terminase large subunit | - |
NIU15_RS13965 | 3211969..3213024 | + | 1056 | WP_004199886.1 | phage portal protein | - |
NIU15_RS13970 | 3213068..3213424 | - | 357 | WP_004202809.1 | putative addiction module antidote protein | Antitoxin |
NIU15_RS13975 | 3213427..3213723 | - | 297 | WP_004199884.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIU15_RS13980 | 3214531..3215651 | + | 1121 | WP_096325434.1 | IS3-like element IS407 family transposase | - |
NIU15_RS13985 | 3215679..3215816 | - | 138 | WP_004202832.1 | hypothetical protein | - |
NIU15_RS13990 | 3215803..3216243 | - | 441 | WP_009935860.1 | BPSL0067 family protein | - |
NIU15_RS13995 | 3216799..3217263 | + | 465 | WP_073699083.1 | hypothetical protein | - |
NIU15_RS14000 | 3217599..3218165 | + | 567 | WP_004525805.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3211658..3215651 | 3993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10840.66 Da Isoelectric Point: 10.1723
>T295432 WP_004199884.1 NZ_OW622535:c3213723-3213427 [Burkholderia mallei]
MFKVLTPPQFDKWLDGLRDPVGSAAINLRIERAKLGNLGQWRAVGDGVNEMKIDVGPGYRAYFVRRGKIIVVVLCGGDKS
TQKKDIKLAKQIAGELED
MFKVLTPPQFDKWLDGLRDPVGSAAINLRIERAKLGNLGQWRAVGDGVNEMKIDVGPGYRAYFVRRGKIIVVVLCGGDKS
TQKKDIKLAKQIAGELED
Download Length: 297 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 12585.41 Da Isoelectric Point: 9.9470
>AT295432 WP_004202809.1 NZ_OW622535:c3213424-3213068 [Burkholderia mallei]
MKISELAEFDGSKYLKDEETIRHYLAQAFEDGNPRLIQAALGNVAKARGMTALARESGVKREALYRALSEGGNAEFATIM
KVVGALGLHLTVAPAEPAPVPAPATTRARSRVRTAAHA
MKISELAEFDGSKYLKDEETIRHYLAQAFEDGNPRLIQAALGNVAKARGMTALARESGVKREALYRALSEGGNAEFATIM
KVVGALGLHLTVAPAEPAPVPAPATTRARSRVRTAAHA
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H2WL39 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3N4G1D3 |