Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 119588..120215 | Replicon | plasmid RHOApb |
Accession | NZ_OW485603 | ||
Organism | Rhodovastum atsumiense strain G2-11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NBY65_RS30565 | Protein ID | WP_150045829.1 |
Coordinates | 119811..120215 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NBY65_RS30560 | Protein ID | WP_150045828.1 |
Coordinates | 119588..119809 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY65_RS30535 (RHOA_PB0135) | 115118..116371 | + | 1254 | WP_250265978.1 | DUF1173 family protein | - |
NBY65_RS30540 (RHOA_PB0137) | 116715..117275 | + | 561 | WP_150045848.1 | hypothetical protein | - |
NBY65_RS30545 (RHOA_PB0138) | 117331..117720 | + | 390 | WP_250265980.1 | hypothetical protein | - |
NBY65_RS30550 (RHOA_PB0139) | 117940..118512 | + | 573 | WP_150045863.1 | MbcA/ParS/Xre antitoxin family protein | - |
NBY65_RS30555 (RHOA_PB0140) | 118509..119189 | + | 681 | WP_150045864.1 | RES family NAD+ phosphorylase | - |
NBY65_RS30560 (RHOA_PB0142) | 119588..119809 | + | 222 | WP_150045828.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NBY65_RS30565 (RHOA_PB0143) | 119811..120215 | + | 405 | WP_150045829.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NBY65_RS30570 (RHOA_PB0144) | 120282..120767 | + | 486 | WP_250265981.1 | DUF2384 domain-containing protein | - |
NBY65_RS30575 (RHOA_PB0145) | 120764..121249 | + | 486 | WP_250265982.1 | RES family NAD+ phosphorylase | - |
NBY65_RS30580 (RHOA_PB0146) | 121371..122717 | + | 1347 | WP_250265983.1 | HipA domain-containing protein | - |
NBY65_RS30585 (RHOA_PB0147) | 122704..123003 | + | 300 | WP_250265984.1 | helix-turn-helix domain-containing protein | - |
NBY65_RS30590 (RHOA_PB0148) | 123519..123689 | + | 171 | WP_162530950.1 | hypothetical protein | - |
NBY65_RS30595 (RHOA_PB0150) | 124380..124589 | - | 210 | WP_250265985.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..199245 | 199245 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15047.31 Da Isoelectric Point: 6.4729
>T295422 WP_150045829.1 NZ_OW485603:119811-120215 [Rhodovastum atsumiense]
VLRYMLDTNLCIRVLRDRPPQLRPRFNAEAAALSISTVVLTELFYGAEKSIRPIENRQAVLDFATRLEVLPFDDTAAAHA
AEIRATLERQGQMIGAYDVLIAGHARSRGLIVVTGNLDEFRRVEGLRSEDWLIA
VLRYMLDTNLCIRVLRDRPPQLRPRFNAEAAALSISTVVLTELFYGAEKSIRPIENRQAVLDFATRLEVLPFDDTAAAHA
AEIRATLERQGQMIGAYDVLIAGHARSRGLIVVTGNLDEFRRVEGLRSEDWLIA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|