295418

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 356662..357428 Replicon chromosome
Accession NZ_OW443151
Organism Vibrio cholerae strain CNRVC190247 isolate YE-NCPHL-18035-PI

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag OC536_RS15910 Protein ID WP_000982260.1
Coordinates 356662..357159 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag OC536_RS15915 Protein ID WP_000246253.1
Coordinates 357156..357428 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC536_RS15865 351797..351979 + 183 WP_032477360.1 DUF645 family protein -
OC536_RS15870 (CNRVC190247_03163) 352631..352951 + 321 WP_000248687.1 DUF4144 domain-containing protein -
OC536_RS15875 (CNRVC190247_03164) 353107..353493 + 387 WP_029628680.1 MmcQ/YjbR family DNA-binding protein -
OC536_RS15880 (CNRVC190247_03165) 353635..353994 + 360 WP_001900224.1 hypothetical protein -
OC536_RS15885 (CNRVC190247_03166) 354144..354440 + 297 WP_001069046.1 hypothetical protein -
OC536_RS15890 (CNRVC190247_03167) 355126..355413 + 288 WP_032477340.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC536_RS15895 (CNRVC190247_03168) 355424..355741 + 318 WP_032477342.1 HigA family addiction module antitoxin -
OC536_RS15900 (CNRVC190247_03169) 355942..356223 + 282 WP_000086649.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OC536_RS15905 (CNRVC190247_03170) 356220..356507 + 288 WP_000869999.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC536_RS15910 (CNRVC190247_03171) 356662..357159 - 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
OC536_RS15915 (CNRVC190247_03172) 357156..357428 - 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
OC536_RS15920 357817..357957 + 141 WP_001952202.1 DUF645 family protein -
OC536_RS15925 (CNRVC190247_03173) 358204..358542 + 339 WP_050503336.1 hypothetical protein -
OC536_RS15930 (CNRVC190247_03174) 358709..359245 + 537 WP_000469478.1 GNAT family protein -
OC536_RS15935 (CNRVC190247_03175) 359416..359778 + 363 WP_000391481.1 DUF6232 family protein -
OC536_RS15940 (CNRVC190247_03177) 359965..360201 - 237 WP_000772125.1 RNA-binding protein -
OC536_RS15945 (CNRVC190247_03178) 360437..360742 + 306 WP_000064427.1 hypothetical protein -
OC536_RS15950 360799..360914 + 116 Protein_354 acetyltransferase -
OC536_RS15955 361083..361188 + 106 Protein_355 DUF645 family protein -
OC536_RS15960 361308..361523 + 216 WP_080284764.1 DUF3709 domain-containing protein -
OC536_RS15965 361535..361753 + 219 Protein_357 DUF3709 domain-containing protein -
OC536_RS15970 362181..362360 + 180 WP_001908899.1 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island qnrVC4 - 308122..375907 67785
- inside Integron qnrVC4 - 308793..373362 64569


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T295418 WP_000982260.1 NZ_OW443151:c357159-356662 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT295418 WP_000246253.1 NZ_OW443151:c357428-357156 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References