295414

Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 344476..345035 Replicon chromosome
Accession NZ_OW443151
Organism Vibrio cholerae strain CNRVC190247 isolate YE-NCPHL-18035-PI

Toxin (Protein)


Gene name relE Uniprot ID D2YI11
Locus tag OC536_RS15780 Protein ID WP_000578473.1
Coordinates 344476..344754 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OC536_RS15785 Protein ID WP_000381186.1
Coordinates 344751..345035 (-) Length 95 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC536_RS15730 (CNRVC190247_03149) 340313..341050 + 738 WP_032477355.1 SDR family oxidoreductase -
OC536_RS15735 341028..341165 + 138 WP_113707170.1 DUF3265 domain-containing protein -
OC536_RS15740 341377..341530 + 154 Protein_312 DUF645 family protein -
OC536_RS15745 (CNRVC190247_03150) 341728..342048 + 321 WP_000248687.1 DUF4144 domain-containing protein -
OC536_RS15750 (CNRVC190247_03151) 342275..342469 + 195 WP_000526238.1 hypothetical protein -
OC536_RS15755 342502..342597 + 96 WP_075042587.1 DUF3265 domain-containing protein -
OC536_RS15760 (CNRVC190247_03152) 342605..342922 - 318 WP_000077449.1 CcdB family protein -
OC536_RS15765 (CNRVC190247_03153) 342922..343167 - 246 WP_001260801.1 type II toxin-antitoxin system CcdA family antitoxin -
OC536_RS15770 (CNRVC190247_03154) 343347..343802 + 456 Protein_318 GNAT family N-acetyltransferase -
OC536_RS15775 (CNRVC190247_03155) 343949..344308 + 360 WP_000609948.1 HNH endonuclease signature motif containing protein -
OC536_RS15780 (CNRVC190247_03156) 344476..344754 - 279 WP_000578473.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
OC536_RS15785 (CNRVC190247_03157) 344751..345035 - 285 WP_000381186.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OC536_RS15790 345647..345853 + 207 WP_080284769.1 DUF3709 domain-containing protein -
OC536_RS15795 (CNRVC190247_03158) 346170..346562 + 393 WP_001085003.1 nuclear transport factor 2 family protein -
OC536_RS15800 (CNRVC190247_03159) 346702..346989 + 288 WP_032477325.1 hypothetical protein -
OC536_RS15805 347492..347560 + 69 Protein_325 acetyltransferase -
OC536_RS15810 347739..347909 + 171 WP_080284771.1 DUF645 family protein -
OC536_RS15815 (CNRVC190247_03161) 348108..348386 - 279 WP_000578475.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
OC536_RS15820 (CNRVC190247_03162) 348383..348667 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
OC536_RS15825 348783..348926 + 144 WP_080284772.1 acetyltransferase -
OC536_RS15830 349026..349202 + 177 WP_001891218.1 DUF645 family protein -
OC536_RS15835 349583..349736 + 154 Protein_331 DUF645 family protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island qnrVC4 - 308122..375907 67785
- inside Integron qnrVC4 - 308793..373362 64569


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 93 a.a.        Molecular weight: 10868.59 Da        Isoelectric Point: 4.6794

>T295414 WP_000578473.1 NZ_OW443151:c344754-344476 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAEKTDELIETKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp


Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10915.28 Da        Isoelectric Point: 8.0775

>AT295414 WP_000381186.1 NZ_OW443151:c345035-344751 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFVEHDIAKVR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB D2YI11


Antitoxin

Source ID Structure

References