Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 332164..332742 Replicon chromosome
Accession NZ_OW443151
Organism Vibrio cholerae strain CNRVC190247 isolate YE-NCPHL-18035-PI

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag OC536_RS15655 Protein ID WP_001180238.1
Coordinates 332164..332481 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A366AI09
Locus tag OC536_RS15660 Protein ID WP_000557291.1
Coordinates 332500..332742 (-) Length 81 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC536_RS15605 327389..327451 + 63 Protein_285 acetyltransferase -
OC536_RS15610 (CNRVC190247_03129) 327509..327796 + 288 WP_032477326.1 toxin HigB-2 -
OC536_RS15615 (CNRVC190247_03130) 327783..328097 + 315 WP_000071008.1 DNA-binding transcriptional regulator -
OC536_RS15620 (CNRVC190247_03131) 328266..328769 + 504 WP_032477327.1 DinB family protein -
OC536_RS15625 (CNRVC190247_03132) 328953..329183 - 231 WP_000838533.1 PAS factor family protein -
OC536_RS15630 (CNRVC190247_03133) 329411..329950 + 540 WP_000884557.1 hydrolase -
OC536_RS15635 330260..330442 + 183 WP_000923320.1 DUF645 family protein -
OC536_RS15640 (CNRVC190247_03134) 330641..330955 + 315 WP_000248689.1 DUF4144 domain-containing protein -
OC536_RS15645 331300..331446 + 147 WP_228006404.1 DUF645 family protein -
OC536_RS15650 (CNRVC190247_03135) 331664..332020 + 357 WP_001094969.1 DUF6404 family protein -
OC536_RS15655 (CNRVC190247_03136) 332164..332481 - 318 WP_001180238.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OC536_RS15660 (CNRVC190247_03137) 332500..332742 - 243 WP_000557291.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OC536_RS15665 (CNRVC190247_03138) 332987..333241 + 255 WP_001223794.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
OC536_RS15670 (CNRVC190247_03139) 333234..333497 + 264 WP_000098715.1 Txe/YoeB family addiction module toxin -
OC536_RS15675 (CNRVC190247_03140) 333654..334136 + 483 WP_000422945.1 GNAT family protein -
OC536_RS15680 (CNRVC190247_03141) 334264..334554 - 291 WP_032477347.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC536_RS15685 (CNRVC190247_03142) 334544..334792 - 249 WP_000213183.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OC536_RS15690 (CNRVC190247_03143) 334991..335305 + 315 WP_000248689.1 DUF4144 domain-containing protein -
OC536_RS15695 335620..335742 + 123 Protein_303 DUF645 family protein -
OC536_RS15700 335723..335824 + 102 WP_080284778.1 Tfp pilus assembly protein -
OC536_RS15705 335977..336150 + 174 WP_172779494.1 hypothetical protein -
OC536_RS15710 (CNRVC190247_03144) 336489..337079 + 591 WP_000589659.1 DUF1294 domain-containing protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island qnrVC4 - 308122..375907 67785
- inside Integron qnrVC4 - 308793..373362 64569


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 106 a.a.        Molecular weight: 12169.01 Da        Isoelectric Point: 9.7495

>T295411 WP_001180238.1 NZ_OW443151:c332481-332164 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKPTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp


Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8931.22 Da        Isoelectric Point: 5.6630

>AT295411 WP_000557291.1 NZ_OW443151:c332742-332500 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGAAFLNTL

Download         Length: 243 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Source ID Structure
AlphaFold DB A0A366AI09

References