Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-Phd |
| Location | 332164..332742 | Replicon | chromosome |
| Accession | NZ_OW443151 | ||
| Organism | Vibrio cholerae strain CNRVC190247 isolate YE-NCPHL-18035-PI | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | OC536_RS15655 | Protein ID | WP_001180238.1 |
| Coordinates | 332164..332481 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A366AI09 |
| Locus tag | OC536_RS15660 | Protein ID | WP_000557291.1 |
| Coordinates | 332500..332742 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OC536_RS15605 | 327389..327451 | + | 63 | Protein_285 | acetyltransferase | - |
| OC536_RS15610 (CNRVC190247_03129) | 327509..327796 | + | 288 | WP_032477326.1 | toxin HigB-2 | - |
| OC536_RS15615 (CNRVC190247_03130) | 327783..328097 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
| OC536_RS15620 (CNRVC190247_03131) | 328266..328769 | + | 504 | WP_032477327.1 | DinB family protein | - |
| OC536_RS15625 (CNRVC190247_03132) | 328953..329183 | - | 231 | WP_000838533.1 | PAS factor family protein | - |
| OC536_RS15630 (CNRVC190247_03133) | 329411..329950 | + | 540 | WP_000884557.1 | hydrolase | - |
| OC536_RS15635 | 330260..330442 | + | 183 | WP_000923320.1 | DUF645 family protein | - |
| OC536_RS15640 (CNRVC190247_03134) | 330641..330955 | + | 315 | WP_000248689.1 | DUF4144 domain-containing protein | - |
| OC536_RS15645 | 331300..331446 | + | 147 | WP_228006404.1 | DUF645 family protein | - |
| OC536_RS15650 (CNRVC190247_03135) | 331664..332020 | + | 357 | WP_001094969.1 | DUF6404 family protein | - |
| OC536_RS15655 (CNRVC190247_03136) | 332164..332481 | - | 318 | WP_001180238.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OC536_RS15660 (CNRVC190247_03137) | 332500..332742 | - | 243 | WP_000557291.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OC536_RS15665 (CNRVC190247_03138) | 332987..333241 | + | 255 | WP_001223794.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| OC536_RS15670 (CNRVC190247_03139) | 333234..333497 | + | 264 | WP_000098715.1 | Txe/YoeB family addiction module toxin | - |
| OC536_RS15675 (CNRVC190247_03140) | 333654..334136 | + | 483 | WP_000422945.1 | GNAT family protein | - |
| OC536_RS15680 (CNRVC190247_03141) | 334264..334554 | - | 291 | WP_032477347.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OC536_RS15685 (CNRVC190247_03142) | 334544..334792 | - | 249 | WP_000213183.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| OC536_RS15690 (CNRVC190247_03143) | 334991..335305 | + | 315 | WP_000248689.1 | DUF4144 domain-containing protein | - |
| OC536_RS15695 | 335620..335742 | + | 123 | Protein_303 | DUF645 family protein | - |
| OC536_RS15700 | 335723..335824 | + | 102 | WP_080284778.1 | Tfp pilus assembly protein | - |
| OC536_RS15705 | 335977..336150 | + | 174 | WP_172779494.1 | hypothetical protein | - |
| OC536_RS15710 (CNRVC190247_03144) | 336489..337079 | + | 591 | WP_000589659.1 | DUF1294 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | qnrVC4 | - | 308122..375907 | 67785 | |
| - | inside | Integron | qnrVC4 | - | 308793..373362 | 64569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12169.01 Da Isoelectric Point: 9.7495
>T295411 WP_001180238.1 NZ_OW443151:c332481-332164 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKPTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKPTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|