Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /GNAT-DUF1778 |
| Location | 322051..322817 | Replicon | chromosome |
| Accession | NZ_OW443151 | ||
| Organism | Vibrio cholerae strain CNRVC190247 isolate YE-NCPHL-18035-PI | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | Q9K2P7 |
| Locus tag | OC536_RS15555 | Protein ID | WP_000982260.1 |
| Coordinates | 322051..322548 (-) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | Q9K2J6 |
| Locus tag | OC536_RS15560 | Protein ID | WP_000246253.1 |
| Coordinates | 322545..322817 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OC536_RS15510 (CNRVC190247_03114) | 317366..318106 | + | 741 | WP_172779533.1 | PhzF family phenazine biosynthesis protein | - |
| OC536_RS15515 (CNRVC190247_03115) | 318438..319094 | + | 657 | WP_000361703.1 | QnrVC family quinolone resistance pentapeptide repeat protein | - |
| OC536_RS15520 (CNRVC190247_03116) | 319326..319577 | + | 252 | WP_001250177.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| OC536_RS15525 (CNRVC190247_03117) | 319567..319854 | + | 288 | WP_172779531.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OC536_RS15530 (CNRVC190247_03118) | 320001..320288 | + | 288 | WP_032477325.1 | hypothetical protein | - |
| OC536_RS15535 (CNRVC190247_03119) | 320515..320802 | + | 288 | WP_032477340.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OC536_RS15540 (CNRVC190247_03120) | 320813..321130 | + | 318 | WP_032477342.1 | HigA family addiction module antitoxin | - |
| OC536_RS15545 (CNRVC190247_03121) | 321331..321612 | + | 282 | WP_000086649.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| OC536_RS15550 (CNRVC190247_03122) | 321609..321896 | + | 288 | WP_000869999.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OC536_RS15555 (CNRVC190247_03123) | 322051..322548 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
| OC536_RS15560 (CNRVC190247_03124) | 322545..322817 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
| OC536_RS15565 | 323172..323354 | + | 183 | WP_032477360.1 | DUF645 family protein | - |
| OC536_RS15570 (CNRVC190247_03125) | 324009..324395 | + | 387 | WP_029628680.1 | MmcQ/YjbR family DNA-binding protein | - |
| OC536_RS15575 (CNRVC190247_03126) | 324537..324896 | + | 360 | WP_001900224.1 | hypothetical protein | - |
| OC536_RS15580 (CNRVC190247_03127) | 325046..325342 | + | 297 | WP_001069046.1 | hypothetical protein | - |
| OC536_RS15585 (CNRVC190247_03128) | 325948..326244 | + | 297 | WP_000617998.1 | Dabb family protein | - |
| OC536_RS15590 | 326557..326679 | + | 123 | WP_080284773.1 | DUF645 family protein | - |
| OC536_RS15595 | 326857..327015 | + | 159 | Protein_283 | acetyltransferase | - |
| OC536_RS15600 | 327119..327272 | + | 154 | Protein_284 | DUF645 family protein | - |
| OC536_RS15605 | 327389..327451 | + | 63 | Protein_285 | acetyltransferase | - |
| OC536_RS15610 (CNRVC190247_03129) | 327509..327796 | + | 288 | WP_032477326.1 | toxin HigB-2 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | qnrVC4 | - | 308122..375907 | 67785 | |
| - | inside | Integron | qnrVC4 | - | 308793..373362 | 64569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T295409 WP_000982260.1 NZ_OW443151:c322548-322051 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 1Y9B | |
| AlphaFold DB | A0A0F2IC79 |