295409

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 322051..322817 Replicon chromosome
Accession NZ_OW443151
Organism Vibrio cholerae strain CNRVC190247 isolate YE-NCPHL-18035-PI

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag OC536_RS15555 Protein ID WP_000982260.1
Coordinates 322051..322548 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag OC536_RS15560 Protein ID WP_000246253.1
Coordinates 322545..322817 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC536_RS15510 (CNRVC190247_03114) 317366..318106 + 741 WP_172779533.1 PhzF family phenazine biosynthesis protein -
OC536_RS15515 (CNRVC190247_03115) 318438..319094 + 657 WP_000361703.1 QnrVC family quinolone resistance pentapeptide repeat protein -
OC536_RS15520 (CNRVC190247_03116) 319326..319577 + 252 WP_001250177.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OC536_RS15525 (CNRVC190247_03117) 319567..319854 + 288 WP_172779531.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC536_RS15530 (CNRVC190247_03118) 320001..320288 + 288 WP_032477325.1 hypothetical protein -
OC536_RS15535 (CNRVC190247_03119) 320515..320802 + 288 WP_032477340.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC536_RS15540 (CNRVC190247_03120) 320813..321130 + 318 WP_032477342.1 HigA family addiction module antitoxin -
OC536_RS15545 (CNRVC190247_03121) 321331..321612 + 282 WP_000086649.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OC536_RS15550 (CNRVC190247_03122) 321609..321896 + 288 WP_000869999.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC536_RS15555 (CNRVC190247_03123) 322051..322548 - 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
OC536_RS15560 (CNRVC190247_03124) 322545..322817 - 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
OC536_RS15565 323172..323354 + 183 WP_032477360.1 DUF645 family protein -
OC536_RS15570 (CNRVC190247_03125) 324009..324395 + 387 WP_029628680.1 MmcQ/YjbR family DNA-binding protein -
OC536_RS15575 (CNRVC190247_03126) 324537..324896 + 360 WP_001900224.1 hypothetical protein -
OC536_RS15580 (CNRVC190247_03127) 325046..325342 + 297 WP_001069046.1 hypothetical protein -
OC536_RS15585 (CNRVC190247_03128) 325948..326244 + 297 WP_000617998.1 Dabb family protein -
OC536_RS15590 326557..326679 + 123 WP_080284773.1 DUF645 family protein -
OC536_RS15595 326857..327015 + 159 Protein_283 acetyltransferase -
OC536_RS15600 327119..327272 + 154 Protein_284 DUF645 family protein -
OC536_RS15605 327389..327451 + 63 Protein_285 acetyltransferase -
OC536_RS15610 (CNRVC190247_03129) 327509..327796 + 288 WP_032477326.1 toxin HigB-2 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island qnrVC4 - 308122..375907 67785
- inside Integron qnrVC4 - 308793..373362 64569


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T295409 WP_000982260.1 NZ_OW443151:c322548-322051 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT295409 WP_000246253.1 NZ_OW443151:c322817-322545 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References