Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 647283..647814 | Replicon | chromosome |
Accession | NZ_OW370493 | ||
Organism | Rickettsia endosymbiont of Oedothorax gibbosus strain Oegibbosus-W744x776 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NBW66_RS03560 | Protein ID | WP_250311722.1 |
Coordinates | 647283..647564 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | NBW66_RS03565 | Protein ID | WP_250311723.1 |
Coordinates | 647551..647814 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW66_RS03540 | 642655..644352 | + | 1698 | WP_250311765.1 | hypothetical protein | - |
NBW66_RS03545 | 644629..645225 | + | 597 | Protein_715 | IS110 family transposase | - |
NBW66_RS03550 | 645238..646128 | - | 891 | WP_250310582.1 | IS982 family transposase | - |
NBW66_RS03555 | 646265..646684 | + | 420 | Protein_717 | transposase | - |
NBW66_RS03560 | 647283..647564 | - | 282 | WP_250311722.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NBW66_RS03565 | 647551..647814 | - | 264 | WP_250311723.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBW66_RS03570 | 648415..649047 | + | 633 | WP_250311724.1 | DUF4065 domain-containing protein | - |
NBW66_RS03575 | 649025..649294 | + | 270 | WP_250311725.1 | Txe/YoeB family addiction module toxin | - |
NBW66_RS03580 | 649840..650676 | + | 837 | WP_250311726.1 | hypothetical protein | - |
NBW66_RS03585 | 650707..651246 | + | 540 | WP_250311727.1 | hypothetical protein | - |
NBW66_RS03590 | 651230..651691 | + | 462 | WP_250311728.1 | lysozyme | - |
NBW66_RS03595 | 651832..652329 | + | 498 | WP_250311729.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11011.76 Da Isoelectric Point: 9.1846
>T295383 WP_250311722.1 NZ_OW370493:c647564-647283 [Rickettsia endosymbiont of Oedothorax gibbosus]
MRTIKRTTQFKRDYTREKRRQHGVTLDNDLSKAIELLVIDAQLPKCMREHPLIGDWKDCRDCHIKSDLVLIYQKSDDYTL
KLIRLGSHSELSL
MRTIKRTTQFKRDYTREKRRQHGVTLDNDLSKAIELLVIDAQLPKCMREHPLIGDWKDCRDCHIKSDLVLIYQKSDDYTL
KLIRLGSHSELSL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|