Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 566085..566616 | Replicon | chromosome |
Accession | NZ_OW370493 | ||
Organism | Rickettsia endosymbiont of Oedothorax gibbosus strain Oegibbosus-W744x776 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NBW66_RS03165 | Protein ID | WP_250311722.1 |
Coordinates | 566085..566366 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | NBW66_RS03170 | Protein ID | WP_250311723.1 |
Coordinates | 566353..566616 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW66_RS03135 | 561606..562859 | - | 1254 | WP_250311720.1 | IS66 family transposase | - |
NBW66_RS03140 | 562897..563247 | - | 351 | WP_250311006.1 | IS66 family insertion sequence element accessory protein TnpB | - |
NBW66_RS03145 | 563241..563594 | - | 354 | WP_250311719.1 | transposase | - |
NBW66_RS03150 | 563668..564240 | + | 573 | WP_284346803.1 | IS110 family transposase | - |
NBW66_RS03155 | 564331..565221 | + | 891 | WP_250310582.1 | IS982 family transposase | - |
NBW66_RS03160 | 565316..565486 | + | 171 | WP_250311721.1 | hypothetical protein | - |
NBW66_RS03165 | 566085..566366 | - | 282 | WP_250311722.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NBW66_RS03170 | 566353..566616 | - | 264 | WP_250311723.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBW66_RS03175 | 567217..567849 | + | 633 | WP_250311724.1 | DUF4065 domain-containing protein | - |
NBW66_RS03180 | 567827..568096 | + | 270 | WP_250311725.1 | Txe/YoeB family addiction module toxin | - |
NBW66_RS03185 | 568642..569478 | + | 837 | WP_250311726.1 | hypothetical protein | - |
NBW66_RS03190 | 569509..570048 | + | 540 | WP_250311727.1 | hypothetical protein | - |
NBW66_RS03195 | 570032..570493 | + | 462 | WP_250311728.1 | lysozyme | - |
NBW66_RS03200 | 570634..571131 | + | 498 | WP_250311729.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11011.76 Da Isoelectric Point: 9.1846
>T295382 WP_250311722.1 NZ_OW370493:c566366-566085 [Rickettsia endosymbiont of Oedothorax gibbosus]
MRTIKRTTQFKRDYTREKRRQHGVTLDNDLSKAIELLVIDAQLPKCMREHPLIGDWKDCRDCHIKSDLVLIYQKSDDYTL
KLIRLGSHSELSL
MRTIKRTTQFKRDYTREKRRQHGVTLDNDLSKAIELLVIDAQLPKCMREHPLIGDWKDCRDCHIKSDLVLIYQKSDDYTL
KLIRLGSHSELSL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|