Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3147528..3148155 | Replicon | chromosome |
Accession | NZ_OW235315 | ||
Organism | Tepidibacter sp. 8C15b |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | M2214_RS15320 | Protein ID | WP_248480679.1 |
Coordinates | 3147528..3147890 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | M2214_RS15325 | Protein ID | WP_248484887.1 |
Coordinates | 3147883..3148155 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2214_RS15300 (T8CH_3136) | 3142894..3143637 | - | 744 | WP_248480671.1 | WecB/TagA/CpsF family glycosyltransferase | - |
M2214_RS15305 (T8CH_3137) | 3143624..3144748 | - | 1125 | WP_248480673.1 | polysaccharide pyruvyl transferase CsaB | - |
M2214_RS15310 (T8CH_3138) | 3144741..3146801 | - | 2061 | WP_248480675.1 | DUF5693 family protein | - |
M2214_RS15315 (T8CH_3139) | 3146857..3147369 | - | 513 | WP_248480677.1 | hypothetical protein | - |
M2214_RS15320 (T8CH_3140) | 3147528..3147890 | - | 363 | WP_248480679.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M2214_RS15325 (T8CH_3141) | 3147883..3148155 | - | 273 | WP_248484887.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
M2214_RS15330 (T8CH_3142) | 3148197..3149357 | - | 1161 | WP_248480681.1 | alanine racemase | - |
M2214_RS15335 (T8CH_3143) | 3149377..3149961 | - | 585 | WP_248480683.1 | germination lipoprotein GerS | - |
M2214_RS15340 (T8CH_3144) | 3149979..3150428 | - | 450 | WP_248480685.1 | CBS domain-containing protein | - |
M2214_RS15345 (T8CH_3145) | 3150431..3150817 | - | 387 | WP_248480687.1 | holo-ACP synthase | - |
M2214_RS15350 (T8CH_3146) | 3150912..3151526 | - | 615 | WP_248480689.1 | hypothetical protein | - |
M2214_RS15355 (T8CH_3147) | 3151694..3152626 | + | 933 | WP_248480691.1 | hypothetical protein | - |
M2214_RS15360 (T8CH_3148) | 3152639..3153034 | - | 396 | WP_248480699.1 | ATP synthase F1 subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13365.35 Da Isoelectric Point: 5.8750
>T295381 WP_248480679.1 NZ_OW235315:c3147890-3147528 [Tepidibacter sp. 8C15b]
VNNNLEIKRGDIFYGDLSPVIGSEQGGVRPVLIIQNDIGNKYSPTVIIAAITSQINKAKLPTHIEINANDYGLNRDSVVL
LEQVRTIDKKRLREKIGSFDNDMMKKVDEGLQISLGLFEI
VNNNLEIKRGDIFYGDLSPVIGSEQGGVRPVLIIQNDIGNKYSPTVIIAAITSQINKAKLPTHIEINANDYGLNRDSVVL
LEQVRTIDKKRLREKIGSFDNDMMKKVDEGLQISLGLFEI
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|