Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
| Location | 3994394..3994920 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | Rv0299 | Uniprot ID | - |
| Locus tag | MR179_RS18825 | Protein ID | WP_003401560.1 |
| Coordinates | 3994394..3994696 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | Rv0298 | Uniprot ID | P9WJ08 |
| Locus tag | MR179_RS18830 | Protein ID | WP_003401555.1 |
| Coordinates | 3994693..3994920 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS18805 | 3992030..3992938 | - | 909 | WP_030022343.1 | protochlorophyllide reductase | - |
| MR179_RS18810 | 3992935..3993567 | - | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
| MR179_RS18815 | 3993703..3994128 | - | 426 | WP_003401566.1 | PIN domain nuclease | - |
| MR179_RS18820 | 3994125..3994346 | - | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | - |
| MR179_RS18825 | 3994394..3994696 | - | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
| MR179_RS18830 | 3994693..3994920 | - | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| MR179_RS18835 | 3995063..3996838 | - | 1776 | WP_010886074.1 | PE family protein | - |
| MR179_RS18840 | 3997017..3998414 | + | 1398 | WP_003401544.1 | sulfatase | - |
| MR179_RS18845 | 3998424..3999227 | + | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T295379 WP_003401560.1 NZ_OW052571:c3994696-3994394 [Mycobacterium tuberculosis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|