Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-CcdA |
Location | 3716005..3716681 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TPQ9 |
Locus tag | MR179_RS17520 | Protein ID | WP_003898500.1 |
Coordinates | 3716268..3716681 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TPR0 |
Locus tag | MR179_RS17515 | Protein ID | WP_003402915.1 |
Coordinates | 3716005..3716271 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS17500 | 3711439..3712419 | - | 981 | WP_003402923.1 | o-succinylbenzoate synthase | - |
MR179_RS17505 | 3712416..3714020 | - | 1605 | WP_003402920.1 | amidohydrolase | - |
MR179_RS17510 | 3714098..3715813 | + | 1716 | WP_003402917.1 | fatty-acid--CoA ligase FadD8 | - |
MR179_RS17515 | 3716005..3716271 | + | 267 | WP_003402915.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
MR179_RS17520 | 3716268..3716681 | + | 414 | WP_003898500.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS17525 | 3716995..3717897 | + | 903 | WP_003915439.1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase | - |
MR179_RS17530 | 3717993..3718877 | + | 885 | WP_003402909.1 | SDR family oxidoreductase | - |
MR179_RS17535 | 3718940..3719326 | + | 387 | WP_003402907.1 | VOC family protein | - |
MR179_RS17540 | 3719446..3720699 | + | 1254 | WP_003911224.1 | inorganic phosphate transporter | - |
MR179_RS17545 | 3720696..3720974 | + | 279 | WP_003402901.1 | hypothetical protein | - |
MR179_RS17550 | 3721034..3721336 | + | 303 | WP_003402896.1 | DUF3349 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14667.78 Da Isoelectric Point: 7.3603
>T295375 WP_003898500.1 NZ_OW052571:3716268-3716681 [Mycobacterium tuberculosis]
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|