Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 3661433..3662079 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O07783 |
Locus tag | MR179_RS17285 | Protein ID | WP_003403122.1 |
Coordinates | 3661687..3662079 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ86 |
Locus tag | MR179_RS17280 | Protein ID | WP_003403125.1 |
Coordinates | 3661433..3661690 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS17245 | 3656751..3657062 | - | 312 | WP_003403164.1 | hypothetical protein | - |
MR179_RS17250 | 3657185..3657880 | + | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
MR179_RS17255 | 3657864..3658394 | + | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
MR179_RS17260 | 3658508..3659014 | + | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
MR179_RS17265 | 3659118..3659354 | + | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | - |
MR179_RS17270 | 3659351..3659764 | + | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | - |
MR179_RS17275 | 3660015..3661250 | + | 1236 | WP_003403128.1 | ATP-binding protein | - |
MR179_RS17280 | 3661433..3661690 | + | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | Antitoxin |
MR179_RS17285 | 3661687..3662079 | + | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | Toxin |
MR179_RS17290 | 3662131..3663681 | - | 1551 | WP_003403119.1 | MlaD family protein | - |
MR179_RS17295 | 3663686..3664828 | - | 1143 | WP_003911253.1 | virulence factor Mce family protein | - |
MR179_RS17300 | 3664891..3666417 | - | 1527 | WP_003403112.1 | virulence factor Mce family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14080.08 Da Isoelectric Point: 4.6558
>T295373 WP_003403122.1 NZ_OW052571:3661687-3662079 [Mycobacterium tuberculosis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F8V4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ86 |