Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 3659118..3659764 Replicon chromosome
Accession NZ_OW052571
Organism Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag MR179_RS17270 Protein ID WP_003403137.1
Coordinates 3659351..3659764 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag MR179_RS17265 Protein ID WP_003403139.1
Coordinates 3659118..3659354 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR179_RS17230 3654192..3654902 - 711 Protein_3403 IS607 family element RNA-guided endonuclease TnpB -
MR179_RS17235 3654904..3655488 - 585 WP_003403171.1 IS607-like element IS1536 family transposase -
MR179_RS17240 3655729..3656679 - 951 WP_003900184.1 DUF1259 domain-containing protein -
MR179_RS17245 3656751..3657062 - 312 WP_003403164.1 hypothetical protein -
MR179_RS17250 3657185..3657880 + 696 WP_003918099.1 two-component system response regulator TcrA -
MR179_RS17255 3657864..3658394 + 531 WP_003917320.1 two component system sensor kinase HK2 -
MR179_RS17260 3658508..3659014 + 507 WP_003900973.1 two component system sensor kinase HK1 -
MR179_RS17265 3659118..3659354 + 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
MR179_RS17270 3659351..3659764 + 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
MR179_RS17275 3660015..3661250 + 1236 WP_003403128.1 ATP-binding protein -
MR179_RS17280 3661433..3661690 + 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
MR179_RS17285 3661687..3662079 + 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
MR179_RS17290 3662131..3663681 - 1551 WP_003403119.1 MlaD family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T295372 WP_003403137.1 NZ_OW052571:3659351-3659764 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT295372 WP_003403139.1 NZ_OW052571:3659118-3659354 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References