Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3645511..3646136 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | MR179_RS17165 | Protein ID | WP_003403218.1 |
| Coordinates | 3645511..3645912 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | MR179_RS17170 | Protein ID | WP_003403213.1 |
| Coordinates | 3645909..3646136 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS17140 | 3640601..3641548 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| MR179_RS17145 | 3641652..3642716 | - | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
| MR179_RS17150 | 3643111..3644202 | - | 1092 | WP_003906403.1 | galactokinase | - |
| MR179_RS17155 | 3644199..3645280 | - | 1082 | Protein_3388 | galactose-1-phosphate uridylyltransferase | - |
| MR179_RS17160 | 3645299..3645382 | - | 84 | Protein_3389 | galactose-1-phosphate uridylyltransferase | - |
| MR179_RS17165 | 3645511..3645912 | - | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| MR179_RS17170 | 3645909..3646136 | - | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| MR179_RS17175 | 3646331..3646573 | - | 243 | WP_003403210.1 | hypothetical protein | - |
| MR179_RS17180 | 3646570..3647319 | - | 750 | WP_003898528.1 | hypothetical protein | - |
| MR179_RS17185 | 3647403..3649970 | + | 2568 | WP_003900188.1 | SEC-C metal-binding domain-containing protein | - |
| MR179_RS17190 | 3649989..3650594 | - | 606 | WP_003898526.1 | hypothetical protein | - |
| MR179_RS17195 | 3650736..3650957 | + | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T295370 WP_003403218.1 NZ_OW052571:c3645912-3645511 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |