Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 3639859..3640508 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67241 |
| Locus tag | MR179_RS17130 | Protein ID | WP_003403236.1 |
| Coordinates | 3639859..3640254 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ34 |
| Locus tag | MR179_RS17135 | Protein ID | WP_003403235.1 |
| Coordinates | 3640254..3640508 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS17105 | 3635186..3636913 | + | 1728 | WP_003900979.1 | exodeoxyribonuclease V subunit alpha | - |
| MR179_RS17110 | 3637006..3638157 | + | 1152 | WP_030023880.1 | FIST N-terminal domain-containing protein | - |
| MR179_RS17115 | 3638229..3638636 | - | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR179_RS17120 | 3638633..3638893 | - | 261 | WP_242364750.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| MR179_RS17125 | 3639025..3639765 | + | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
| MR179_RS17130 | 3639859..3640254 | - | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
| MR179_RS17135 | 3640254..3640508 | - | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
| MR179_RS17140 | 3640601..3641548 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| MR179_RS17145 | 3641652..3642716 | - | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
| MR179_RS17150 | 3643111..3644202 | - | 1092 | WP_003906403.1 | galactokinase | - |
| MR179_RS17155 | 3644199..3645280 | - | 1082 | Protein_3388 | galactose-1-phosphate uridylyltransferase | - |
| MR179_RS17160 | 3645299..3645382 | - | 84 | Protein_3389 | galactose-1-phosphate uridylyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T295369 WP_003403236.1 NZ_OW052571:c3640254-3639859 [Mycobacterium tuberculosis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4XGR | |
| PDB | 4XGQ |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4XGR | |
| PDB | 4XGQ | |
| AlphaFold DB | A0A7U4BSC2 |