Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3600895..3601583 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB2 |
Locus tag | MR179_RS16920 | Protein ID | WP_003403386.1 |
Coordinates | 3601146..3601583 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O06777 |
Locus tag | MR179_RS16915 | Protein ID | WP_003911263.1 |
Coordinates | 3600895..3601149 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS16895 | 3597609..3597782 | - | 174 | WP_003898549.1 | hypothetical protein | - |
MR179_RS16900 | 3597779..3598117 | - | 339 | WP_003403405.1 | PIN domain-containing protein | - |
MR179_RS16905 | 3598029..3598355 | - | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR179_RS16910 | 3598418..3600781 | - | 2364 | WP_003898547.1 | arylsulfatase AtsD | - |
MR179_RS16915 | 3600895..3601149 | + | 255 | WP_003911263.1 | antitoxin VapB7 | Antitoxin |
MR179_RS16920 | 3601146..3601583 | + | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS16925 | 3601693..3601938 | + | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
MR179_RS16930 | 3601925..3602233 | + | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
MR179_RS16935 | 3602509..3603225 | + | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
MR179_RS16940 | 3603301..3603456 | + | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MR179_RS16945 | 3603551..3603934 | + | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
MR179_RS16950 | 3604322..3605332 | - | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15245.39 Da Isoelectric Point: 5.1865
>T295364 WP_003403386.1 NZ_OW052571:3601146-3601583 [Mycobacterium tuberculosis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSW5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806JQG1 |