Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 3339883..3340502 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | MR179_RS15595 | Protein ID | WP_003404726.1 |
Coordinates | 3339883..3340317 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | P9WJ06 |
Locus tag | MR179_RS15600 | Protein ID | WP_003898641.1 |
Coordinates | 3340323..3340502 (-) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS15570 | 3335218..3336456 | + | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
MR179_RS15575 | 3336458..3337966 | + | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
MR179_RS15580 | 3338133..3338363 | + | 231 | WP_003898642.1 | hypothetical protein | - |
MR179_RS15585 | 3338498..3338947 | - | 450 | WP_003404738.1 | hypothetical protein | - |
MR179_RS15590 | 3339012..3339785 | - | 774 | WP_003404735.1 | VOC family protein | - |
MR179_RS15595 | 3339883..3340317 | - | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
MR179_RS15600 | 3340323..3340502 | - | 180 | WP_003898641.1 | antitoxin | Antitoxin |
MR179_RS15605 | 3340628..3340786 | - | 159 | WP_003404720.1 | hypothetical protein | - |
MR179_RS15610 | 3341059..3343452 | - | 2394 | WP_242364749.1 | cation-translocating P-type ATPase | - |
MR179_RS15615 | 3343449..3345029 | - | 1581 | WP_003909313.1 | serine hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T295362 WP_003404726.1 NZ_OW052571:c3340317-3339883 [Mycobacterium tuberculosis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|