Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3123843..3124474 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P9WIH8 |
| Locus tag | MR179_RS14540 | Protein ID | WP_003898728.1 |
| Coordinates | 3124163..3124474 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TGZ7 |
| Locus tag | MR179_RS14535 | Protein ID | WP_003405836.1 |
| Coordinates | 3123843..3124163 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS14510 | 3119039..3119677 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
| MR179_RS14515 | 3119674..3120921 | + | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
| MR179_RS14520 | 3120911..3121168 | + | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
| MR179_RS14525 | 3121178..3122290 | + | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
| MR179_RS14530 | 3122297..3123833 | - | 1537 | Protein_2874 | carboxylesterase/lipase family protein | - |
| MR179_RS14535 | 3123843..3124163 | + | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
| MR179_RS14540 | 3124163..3124474 | + | 312 | WP_003898728.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
| MR179_RS14545 | 3124586..3125743 | + | 1158 | WP_003898727.1 | AI-2E family transporter | - |
| MR179_RS14550 | 3125750..3126394 | - | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
| MR179_RS14555 | 3126450..3127538 | + | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
| MR179_RS14560 | 3127569..3128993 | + | 1425 | WP_030026248.1 | class II fumarate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11049.76 Da Isoelectric Point: 4.9371
>T295359 WP_003898728.1 NZ_OW052571:3124163-3124474 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|