Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3115150..3115718 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TH08 |
Locus tag | MR179_RS14485 | Protein ID | WP_003405865.1 |
Coordinates | 3115150..3115524 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TH07 |
Locus tag | MR179_RS14490 | Protein ID | WP_003405863.1 |
Coordinates | 3115521..3115718 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS14450 | 3111500..3112270 | + | 771 | Protein_2858 | adenylate/guanylate cyclase domain-containing protein | - |
MR179_RS14455 | 3112222..3112431 | - | 210 | WP_003911400.1 | hypothetical protein | - |
MR179_RS14460 | 3112465..3113163 | + | 699 | WP_031646953.1 | hypothetical protein | - |
MR179_RS14465 | 3113178..3113501 | - | 324 | WP_003405871.1 | putative quinol monooxygenase | - |
MR179_RS14470 | 3113744..3114019 | + | 276 | WP_003405867.1 | hypothetical protein | - |
MR179_RS14475 | 3113946..3114131 | - | 186 | WP_003901093.1 | hypothetical protein | - |
MR179_RS14480 | 3114249..3114947 | - | 699 | WP_003898733.1 | hypothetical protein | - |
MR179_RS14485 | 3115150..3115524 | - | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS14490 | 3115521..3115718 | - | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR179_RS14495 | 3115806..3116879 | - | 1074 | WP_003898732.1 | redox-regulated ATPase YchF | - |
MR179_RS14500 | 3116942..3117925 | + | 984 | WP_003898731.1 | hypothetical protein | - |
MR179_RS14505 | 3117942..3118949 | - | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
MR179_RS14510 | 3119039..3119677 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T295358 WP_003405865.1 NZ_OW052571:c3115524-3115150 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|