Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2783692..2784347 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFA6 |
| Locus tag | MR179_RS13005 | Protein ID | WP_003898861.1 |
| Coordinates | 2783946..2784347 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TIK2 |
| Locus tag | MR179_RS13000 | Protein ID | WP_003407272.1 |
| Coordinates | 2783692..2783949 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS12980 | 2778879..2780846 | - | 1968 | WP_003407285.1 | primosomal protein N' | - |
| MR179_RS12985 | 2780927..2781664 | - | 738 | WP_031647000.1 | lysoplasmalogenase | - |
| MR179_RS12990 | 2781663..2782625 | + | 963 | WP_003407279.1 | alpha/beta hydrolase | - |
| MR179_RS12995 | 2782650..2783609 | + | 960 | WP_003407276.1 | alpha/beta hydrolase | - |
| MR179_RS13000 | 2783692..2783949 | + | 258 | WP_003407272.1 | CopG family transcriptional regulator | Antitoxin |
| MR179_RS13005 | 2783946..2784347 | + | 402 | WP_003898861.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR179_RS13010 | 2784602..2786332 | + | 1731 | WP_010886114.1 | PE family protein | - |
| MR179_RS13015 | 2786378..2787412 | - | 1035 | WP_003407264.1 | AraC family transcriptional regulator | - |
| MR179_RS13020 | 2787490..2788875 | + | 1386 | WP_003911514.1 | cytochrome P450 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14952.43 Da Isoelectric Point: 11.4656
>T295354 WP_003898861.1 NZ_OW052571:2783946-2784347 [Mycobacterium tuberculosis]
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQDLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQDLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A045ISB0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TIK2 |