Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2409095..2409708 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFA2 |
Locus tag | MR179_RS11335 | Protein ID | WP_003408465.1 |
Coordinates | 2409319..2409708 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ52 |
Locus tag | MR179_RS11330 | Protein ID | WP_003408469.1 |
Coordinates | 2409095..2409322 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS11310 | 2404987..2405697 | + | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
MR179_RS11315 | 2405687..2406106 | + | 420 | WP_003408483.1 | hypothetical protein | - |
MR179_RS11320 | 2406149..2407396 | - | 1248 | WP_003408476.1 | serine hydrolase | - |
MR179_RS11325 | 2407393..2408877 | - | 1485 | WP_003408473.1 | biotin carboxylase | - |
MR179_RS11330 | 2409095..2409322 | + | 228 | WP_003408469.1 | antitoxin | Antitoxin |
MR179_RS11335 | 2409319..2409708 | + | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS11340 | 2409756..2409887 | - | 132 | Protein_2244 | IS3 family transposase | - |
MR179_RS11350 | 2410318..2411097 | - | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
MR179_RS11355 | 2411111..2411929 | - | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
MR179_RS11360 | 2411982..2412332 | - | 351 | WP_003898986.1 | cupin domain-containing protein | - |
MR179_RS11365 | 2412332..2413162 | - | 831 | WP_003916363.1 | cyclase family protein | - |
MR179_RS11370 | 2413165..2414079 | - | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T295351 WP_003408465.1 NZ_OW052571:2409319-2409708 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUI9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAN9 |