Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2161036..2161580 Replicon chromosome
Accession NZ_OW052571
Organism Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag MR179_RS10170 Protein ID WP_003409896.1
Coordinates 2161284..2161580 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag MR179_RS10165 Protein ID WP_003409899.1
Coordinates 2161036..2161287 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR179_RS10140 2156763..2157560 - 798 WP_003899101.1 ABC transporter permease -
MR179_RS10145 2158459..2159679 + 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
MR179_RS10150 2159712..2159984 + 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
MR179_RS10155 2159988..2160395 + 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
MR179_RS10160 2160555..2161049 - 495 WP_003899099.1 hypothetical protein -
MR179_RS10165 2161036..2161287 + 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
MR179_RS10170 2161284..2161580 + 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MR179_RS10175 2161629..2162243 + 615 WP_003901296.1 hypothetical protein -
MR179_RS10180 2162132..2162677 - 546 WP_003409891.1 SecB-like chaperone -
MR179_RS10185 2162674..2163123 - 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
MR179_RS10190 2163165..2163542 - 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
MR179_RS10195 2163517..2164038 + 522 WP_003904745.1 hypothetical protein -
MR179_RS10200 2164012..2164323 - 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
MR179_RS10205 2164320..2164535 - 216 WP_003409878.1 antitoxin -
MR179_RS10210 2164775..2165071 + 297 WP_003409877.1 hypothetical protein -
MR179_RS10215 2165072..2165263 + 192 WP_003409876.1 hypothetical protein -
MR179_RS10220 2165284..2166186 + 903 WP_031657727.1 hypothetical protein -
MR179_RS10225 2166197..2166547 + 351 WP_003899096.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T295347 WP_003409896.1 NZ_OW052571:2161284-2161580 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT295347 WP_003409899.1 NZ_OW052571:2161036-2161287 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References