Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mbcAT/RES-TIGR02293 |
Location | 2131623..2132521 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mbcT | Uniprot ID | P64908 |
Locus tag | MR179_RS10005 | Protein ID | WP_003410001.1 |
Coordinates | 2131961..2132521 (+) | Length | 187 a.a. |
Antitoxin (Protein)
Gene name | mbcA | Uniprot ID | P64910 |
Locus tag | MR179_RS10000 | Protein ID | WP_003410003.1 |
Coordinates | 2131623..2131964 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS09965 | 2127276..2127632 | + | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
MR179_RS09970 | 2127685..2127957 | + | 273 | WP_003410017.1 | DUF1490 family protein | - |
MR179_RS09975 | 2127954..2130269 | + | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
MR179_RS09980 | 2130369..2130617 | + | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | - |
MR179_RS09985 | 2130611..2130955 | + | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | - |
MR179_RS09990 | 2131044..2131379 | + | 336 | WP_003410009.1 | dehydrogenase | - |
MR179_RS09995 | 2131280..2131537 | - | 258 | WP_003410006.1 | hypothetical protein | - |
MR179_RS10000 | 2131623..2131964 | + | 342 | WP_003410003.1 | DUF2384 domain-containing protein | Antitoxin |
MR179_RS10005 | 2131961..2132521 | + | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | Toxin |
MR179_RS10010 | 2133041..2133580 | - | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
MR179_RS10015 | 2133806..2134234 | - | 429 | WP_003409992.1 | cellulose-binding protein | - |
MR179_RS10020 | 2134650..2135249 | - | 600 | WP_003409989.1 | L-lysine exporter | - |
MR179_RS10025 | 2135358..2136269 | + | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
MR179_RS10030 | 2136354..2136584 | - | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
MR179_RS10035 | 2136699..2137352 | + | 654 | WP_003409976.1 | cutinase Cfp21 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 187 a.a. Molecular weight: 20248.70 Da Isoelectric Point: 4.5091
>T295345 WP_003410001.1 NZ_OW052571:2131961-2132521 [Mycobacterium tuberculosis]
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
Download Length: 561 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12488.33 Da Isoelectric Point: 4.8359
>AT295345 WP_003410003.1 NZ_OW052571:2131623-2131964 [Mycobacterium tuberculosis]
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|