Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2106589..2107215 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | MR179_RS09880 | Protein ID | WP_003410075.1 |
Coordinates | 2106589..2106987 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A806JLL8 |
Locus tag | MR179_RS09885 | Protein ID | WP_003911750.1 |
Coordinates | 2106988..2107215 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS09850 | 2102188..2103444 | + | 1257 | WP_003410095.1 | HNH endonuclease signature motif containing protein | - |
MR179_RS09855 | 2103572..2104162 | - | 591 | WP_003899131.1 | IS110 family transposase | - |
MR179_RS09860 | 2104116..2104736 | - | 621 | WP_003410086.1 | IS110 family transposase | - |
MR179_RS09865 | 2104824..2105003 | + | 180 | Protein_1949 | hypothetical protein | - |
MR179_RS09870 | 2105440..2105874 | - | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
MR179_RS09875 | 2105975..2106406 | + | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
MR179_RS09880 | 2106589..2106987 | - | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
MR179_RS09885 | 2106988..2107215 | - | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR179_RS09890 | 2107474..2108643 | + | 1170 | WP_003899126.1 | ATP-binding protein | - |
MR179_RS09895 | 2108832..2109176 | + | 345 | WP_003410065.1 | ferredoxin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T295343 WP_003410075.1 NZ_OW052571:c2106987-2106589 [Mycobacterium tuberculosis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|