Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2000479..2001174 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O53501 |
Locus tag | MR179_RS09400 | Protein ID | WP_003410811.1 |
Coordinates | 2000740..2001174 (+) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TMN0 |
Locus tag | MR179_RS09395 | Protein ID | WP_003410814.1 |
Coordinates | 2000479..2000733 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS09365 | 1995827..1996021 | + | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
MR179_RS09370 | 1996018..1996893 | + | 876 | WP_003411023.1 | proteasome subunit beta | - |
MR179_RS09375 | 1996890..1997636 | + | 747 | WP_003906749.1 | proteasome subunit alpha | - |
MR179_RS09380 | 1998176..1998907 | - | 732 | WP_003900467.1 | PPE family protein | - |
MR179_RS09385 | 1998963..1999259 | - | 297 | WP_003410820.1 | PE family protein | - |
MR179_RS09390 | 2000206..2000463 | + | 258 | WP_003410816.1 | hypothetical protein | - |
MR179_RS09395 | 2000479..2000733 | + | 255 | WP_003410814.1 | antitoxin | Antitoxin |
MR179_RS09400 | 2000740..2001174 | + | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS09405 | 2001153..2001986 | - | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
MR179_RS09410 | 2001979..2005020 | - | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T295340 WP_003410811.1 NZ_OW052571:2000740-2001174 [Mycobacterium tuberculosis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB09 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TMN0 |