Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/- |
Location | 1963894..1964423 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | parE | Uniprot ID | G0TMR4 |
Locus tag | MR179_RS09195 | Protein ID | WP_003411124.1 |
Coordinates | 1964106..1964423 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P9WJ74 |
Locus tag | MR179_RS09190 | Protein ID | WP_003411127.1 |
Coordinates | 1963894..1964109 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS09165 | 1959302..1959592 | + | 291 | WP_003900476.1 | YggT family protein | - |
MR179_RS09175 | 1961218..1962000 | + | 783 | WP_003411131.1 | cell wall synthesis protein Wag31 | - |
MR179_RS09180 | 1962095..1962451 | + | 357 | WP_003411130.1 | hypothetical protein | - |
MR179_RS09185 | 1962581..1963639 | - | 1059 | WP_003411129.1 | phosphoribosyltransferase family protein | - |
MR179_RS09190 | 1963894..1964109 | + | 216 | WP_003411127.1 | antitoxin ParD2 | Antitoxin |
MR179_RS09195 | 1964106..1964423 | + | 318 | WP_003411124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MR179_RS09205 | 1964894..1966240 | + | 1347 | WP_003411121.1 | M20/M25/M40 family metallo-hydrolase | - |
MR179_RS09210 | 1966288..1966818 | + | 531 | WP_003411119.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
MR179_RS09215 | 1966823..1967896 | - | 1074 | WP_003411116.1 | quinone-dependent dihydroorotate dehydrogenase | - |
MR179_RS09220 | 1967932..1968213 | - | 282 | WP_003411112.1 | DUF5703 family protein | - |
MR179_RS09225 | 1968210..1969286 | - | 1077 | WP_030030054.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12312.88 Da Isoelectric Point: 6.4831
>T295339 WP_003411124.1 NZ_OW052571:1964106-1964423 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TMR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAJ4 |