Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1556479..1557131 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPX1 |
| Locus tag | MR179_RS07275 | Protein ID | WP_003412752.1 |
| Coordinates | 1556479..1556904 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ24 |
| Locus tag | MR179_RS07280 | Protein ID | WP_003412749.1 |
| Coordinates | 1556910..1557131 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS07250 | 1551484..1552041 | + | 558 | WP_003412768.1 | MaoC family dehydratase | - |
| MR179_RS07255 | 1552038..1552859 | + | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
| MR179_RS07260 | 1553118..1554221 | + | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
| MR179_RS07265 | 1554232..1555278 | + | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
| MR179_RS07270 | 1555275..1556456 | + | 1182 | WP_003899351.1 | dihydrolipoamide acetyltransferase family protein | - |
| MR179_RS07275 | 1556479..1556904 | - | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR179_RS07280 | 1556910..1557131 | - | 222 | WP_003412749.1 | antitoxin | Antitoxin |
| MR179_RS07285 | 1557184..1557936 | - | 753 | WP_003900859.1 | hypothetical protein | - |
| MR179_RS07290 | 1557926..1558549 | - | 624 | WP_003900858.1 | TIGR00725 family protein | - |
| MR179_RS07295 | 1558685..1558891 | + | 207 | WP_003899347.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T295338 WP_003412752.1 NZ_OW052571:c1556904-1556479 [Mycobacterium tuberculosis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TPX1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BW03 |