295336

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 1496351..1497060 Replicon chromosome
Accession NZ_OW052571
Organism Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag MR179_RS06995 Protein ID WP_003413164.1
Coordinates 1496647..1497060 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag MR179_RS06990 Protein ID WP_003413167.1
Coordinates 1496351..1496608 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR179_RS06950 1491444..1491956 + 513 WP_003413197.1 Holliday junction resolvase RuvX -
MR179_RS06955 1491949..1493202 + 1254 WP_003413196.1 endolytic transglycosylase MltG -
MR179_RS06960 1493199..1494008 + 810 WP_003413193.1 shikimate dehydrogenase -
MR179_RS06965 1494020..1494439 + 420 WP_003413190.1 A24 family peptidase -
MR179_RS06970 1494850..1495095 + 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
MR179_RS06975 1495092..1495487 + 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
MR179_RS06980 1495587..1495961 + 375 WP_003413177.1 hypothetical protein -
MR179_RS06985 1495977..1496354 - 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
MR179_RS06990 1496351..1496608 - 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
MR179_RS06995 1496647..1497060 - 414 WP_003413164.1 PIN domain nuclease Toxin
MR179_RS07000 1497153..1497431 - 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
MR179_RS07005 1497428..1498090 - 663 WP_003900848.1 LppA family lipoprotein -
MR179_RS07010 1498087..1498746 - 660 WP_003900846.1 LppA family lipoprotein -
MR179_RS07015 1498873..1500084 - 1212 WP_003900845.1 alpha/beta hydrolase family protein -
MR179_RS07020 1500380..1500694 - 315 WP_009937839.1 hypothetical protein -
MR179_RS07025 1500802..1502007 + 1206 WP_003413027.1 chorismate synthase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T295336 WP_003413164.1 NZ_OW052571:c1497060-1496647 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT295336 WP_003413167.1 NZ_OW052571:c1496608-1496351 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References