Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 1495977..1496608 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ28 |
Locus tag | MR179_RS06985 | Protein ID | WP_003413174.1 |
Coordinates | 1495977..1496354 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P95006 |
Locus tag | MR179_RS06990 | Protein ID | WP_003413167.1 |
Coordinates | 1496351..1496608 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS06950 | 1491444..1491956 | + | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
MR179_RS06955 | 1491949..1493202 | + | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
MR179_RS06960 | 1493199..1494008 | + | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
MR179_RS06965 | 1494020..1494439 | + | 420 | WP_003413190.1 | A24 family peptidase | - |
MR179_RS06970 | 1494850..1495095 | + | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
MR179_RS06975 | 1495092..1495487 | + | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
MR179_RS06980 | 1495587..1495961 | + | 375 | WP_003413177.1 | hypothetical protein | - |
MR179_RS06985 | 1495977..1496354 | - | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS06990 | 1496351..1496608 | - | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
MR179_RS06995 | 1496647..1497060 | - | 414 | WP_003413164.1 | PIN domain nuclease | - |
MR179_RS07000 | 1497153..1497431 | - | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MR179_RS07005 | 1497428..1498090 | - | 663 | WP_003900848.1 | LppA family lipoprotein | - |
MR179_RS07010 | 1498087..1498746 | - | 660 | WP_003900846.1 | LppA family lipoprotein | - |
MR179_RS07015 | 1498873..1500084 | - | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
MR179_RS07020 | 1500380..1500694 | - | 315 | WP_009937839.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13728.72 Da Isoelectric Point: 4.4687
>T295335 WP_003413174.1 NZ_OW052571:c1496354-1495977 [Mycobacterium tuberculosis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ28 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C9W5 |