Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1434431..1435145 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQK0 |
Locus tag | MR179_RS06710 | Protein ID | WP_003413460.1 |
Coordinates | 1434431..1434871 (-) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MR179_RS06715 | Protein ID | WP_030030794.1 |
Coordinates | 1434858..1435145 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS06685 | 1430343..1431017 | - | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
MR179_RS06690 | 1431145..1432044 | + | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
MR179_RS06695 | 1432073..1432918 | + | 846 | WP_003413466.1 | acyl-CoA thioesterase II | - |
MR179_RS06700 | 1432926..1433522 | + | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
MR179_RS06705 | 1433655..1434410 | + | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
MR179_RS06710 | 1434431..1434871 | - | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS06715 | 1434858..1435145 | - | 288 | WP_030030794.1 | antitoxin | Antitoxin |
MR179_RS06720 | 1435256..1436827 | - | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
MR179_RS06725 | 1436824..1437282 | - | 459 | WP_003413451.1 | DUF350 domain-containing protein | - |
MR179_RS06730 | 1437307..1437738 | - | 432 | WP_003899390.1 | DUF4247 domain-containing protein | - |
MR179_RS06735 | 1437735..1438229 | - | 495 | WP_003413444.1 | DUF2617 family protein | - |
MR179_RS06740 | 1438240..1438860 | - | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
MR179_RS06745 | 1439077..1439481 | - | 405 | WP_003899389.1 | type II toxin-antitoxin system VapC family toxin | - |
MR179_RS06750 | 1439478..1439723 | - | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T295333 WP_003413460.1 NZ_OW052571:c1434871-1434431 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|