Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1295144..1295831 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TF65 |
Locus tag | MR179_RS05875 | Protein ID | WP_003414064.1 |
Coordinates | 1295144..1295539 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | MR179_RS05880 | Protein ID | WP_003414061.1 |
Coordinates | 1295565..1295831 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS05840 | 1291041..1291778 | - | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
MR179_RS05845 | 1291934..1292734 | + | 801 | WP_003911953.1 | thymidylate synthase | - |
MR179_RS05850 | 1292805..1293284 | + | 480 | WP_003414073.1 | dihydrofolate reductase | - |
MR179_RS05855 | 1293285..1293359 | - | 75 | Protein_1161 | hypothetical protein | - |
MR179_RS05860 | 1293358..1293777 | + | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
MR179_RS05865 | 1293774..1294868 | + | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
MR179_RS05870 | 1294878..1295147 | + | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MR179_RS05875 | 1295144..1295539 | + | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS05880 | 1295565..1295831 | + | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR179_RS05885 | 1295828..1296244 | + | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
MR179_RS05890 | 1296331..1297953 | + | 1623 | WP_003906897.1 | class I SAM-dependent DNA methyltransferase | - |
MR179_RS05895 | 1297950..1298225 | + | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
MR179_RS05905 | 1298469..1299221 | + | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
MR179_RS05910 | 1299290..1300192 | + | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T295330 WP_003414064.1 NZ_OW052571:1295144-1295539 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|