Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1255677..1256247 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | MR179_RS05655 | Protein ID | WP_003414166.1 |
| Coordinates | 1255891..1256247 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | MR179_RS05650 | Protein ID | WP_003901465.1 |
| Coordinates | 1255677..1255907 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS05610 | 1250695..1251006 | - | 312 | WP_003414190.1 | hypothetical protein | - |
| MR179_RS05615 | 1251111..1251368 | - | 258 | WP_003899489.1 | hypothetical protein | - |
| MR179_RS05620 | 1252478..1252738 | - | 261 | Protein_1114 | transposase | - |
| MR179_RS05625 | 1252955..1253146 | - | 192 | WP_003414184.1 | hypothetical protein | - |
| MR179_RS05630 | 1253143..1253547 | - | 405 | WP_009938577.1 | hypothetical protein | - |
| MR179_RS05635 | 1253695..1253949 | + | 255 | WP_003917684.1 | hypothetical protein | - |
| MR179_RS05640 | 1254125..1254592 | - | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
| MR179_RS05645 | 1254591..1255634 | + | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| MR179_RS05650 | 1255677..1255907 | + | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
| MR179_RS05655 | 1255891..1256247 | + | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| MR179_RS05660 | 1256349..1257998 | - | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
| MR179_RS05665 | 1258017..1258604 | - | 588 | WP_003914429.1 | DUF3558 family protein | - |
| MR179_RS05670 | 1258777..1259103 | + | 327 | WP_003414157.1 | hypothetical protein | - |
| MR179_RS05675 | 1259107..1260795 | + | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T295329 WP_003414166.1 NZ_OW052571:1255891-1256247 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|