Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 1188249..1188797 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | MR179_RS05315 | Protein ID | WP_003414602.1 |
Coordinates | 1188249..1188512 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | MR179_RS05320 | Protein ID | WP_003414599.1 |
Coordinates | 1188516..1188797 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS05295 | 1183323..1184564 | + | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
MR179_RS05300 | 1184572..1185786 | + | 1215 | WP_003899518.1 | zinc metalloprotease Rip | - |
MR179_RS05305 | 1185803..1186966 | + | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
MR179_RS05310 | 1187022..1187876 | + | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
MR179_RS05315 | 1188249..1188512 | - | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MR179_RS05320 | 1188516..1188797 | - | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
MR179_RS05325 | 1189069..1190880 | + | 1812 | WP_003414596.1 | penicillin-binding protein | - |
MR179_RS05330 | 1190962..1191342 | - | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
MR179_RS05335 | 1191339..1191587 | - | 249 | WP_003913411.1 | antitoxin VapB23 | - |
MR179_RS05340 | 1191691..1192275 | + | 585 | WP_003899514.1 | DUF1707 domain-containing protein | - |
MR179_RS05345 | 1192317..1193174 | + | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T295326 WP_003414602.1 NZ_OW052571:c1188512-1188249 [Mycobacterium tuberculosis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|