Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1182509..1183196 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | MR179_RS05285 | Protein ID | WP_003414624.1 |
Coordinates | 1182509..1182952 (-) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | MR179_RS05290 | Protein ID | WP_003414620.1 |
Coordinates | 1182939..1183196 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS05260 | 1178357..1178623 | - | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
MR179_RS05265 | 1178723..1179304 | - | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
MR179_RS05270 | 1179400..1181148 | - | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
MR179_RS05275 | 1181480..1181671 | - | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
MR179_RS05280 | 1181767..1182429 | - | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
MR179_RS05285 | 1182509..1182952 | - | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS05290 | 1182939..1183196 | - | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
MR179_RS05295 | 1183323..1184564 | + | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
MR179_RS05300 | 1184572..1185786 | + | 1215 | WP_003899518.1 | zinc metalloprotease Rip | - |
MR179_RS05305 | 1185803..1186966 | + | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
MR179_RS05310 | 1187022..1187876 | + | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T295325 WP_003414624.1 NZ_OW052571:c1182952-1182509 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|