Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 661762..662436 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF52 |
| Locus tag | MR179_RS02930 | Protein ID | WP_003417282.1 |
| Coordinates | 662008..662436 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TI59 |
| Locus tag | MR179_RS02925 | Protein ID | WP_003417286.1 |
| Coordinates | 661762..662004 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS02900 | 658358..659362 | + | 1005 | WP_003914475.1 | GTP 3',8-cyclase MoaA | - |
| MR179_RS02905 | 659459..659833 | + | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
| MR179_RS02910 | 659830..660363 | + | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
| MR179_RS02915 | 660364..661029 | + | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
| MR179_RS02920 | 661026..661640 | + | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
| MR179_RS02925 | 661762..662004 | + | 243 | WP_003417286.1 | CopG family transcriptional regulator | Antitoxin |
| MR179_RS02930 | 662008..662436 | + | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR179_RS02935 | 662515..663306 | - | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
| MR179_RS02940 | 663306..665078 | - | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
| MR179_RS02945 | 665207..665641 | - | 435 | WP_003417269.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
| MR179_RS02950 | 665638..665976 | - | 339 | WP_003417267.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
| MR179_RS02955 | 666213..666614 | + | 402 | WP_003417264.1 | cytidine deaminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T295323 WP_003417282.1 NZ_OW052571:662008-662436 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBL0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TI59 |