Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 538539..539224 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TIR9 |
Locus tag | MR179_RS02465 | Protein ID | WP_003417998.1 |
Coordinates | 538539..538949 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MR179_RS02470 | Protein ID | WP_003912220.1 |
Coordinates | 538946..539224 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS02450 | 533978..535567 | + | 1590 | WP_003900682.1 | IMP dehydrogenase | - |
MR179_RS02455 | 535587..536714 | + | 1128 | WP_003418005.1 | GuaB3 family IMP dehydrogenase-related protein | - |
MR179_RS02460 | 536770..538506 | + | 1737 | WP_003418002.1 | cholesterol oxidase | - |
MR179_RS02465 | 538539..538949 | - | 411 | WP_003417998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR179_RS02470 | 538946..539224 | - | 279 | WP_003912220.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MR179_RS02475 | 539280..540167 | - | 888 | WP_003900050.1 | alpha-ketoglutarate-dependent sulfate ester dioxygenase | - |
MR179_RS02480 | 540229..540795 | + | 567 | WP_003417984.1 | TetR/AcrR family transcriptional regulator | - |
MR179_RS02485 | 540913..541617 | + | 705 | WP_003417980.1 | dTDP-4-amino-4,6-dideoxyglucose formyltransferase | - |
MR179_RS02490 | 541634..543235 | + | 1602 | WP_242364767.1 | FAD/NAD(P)-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14695.84 Da Isoelectric Point: 5.1784
>T295320 WP_003417998.1 NZ_OW052571:c538949-538539 [Mycobacterium tuberculosis]
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|