Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/- |
| Location | 4258747..4259276 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | G0TMR4 |
| Locus tag | MR177_RS19860 | Protein ID | WP_003411124.1 |
| Coordinates | 4258959..4259276 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | P9WJ74 |
| Locus tag | MR177_RS19855 | Protein ID | WP_003411127.1 |
| Coordinates | 4258747..4258962 (+) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS19825 | 4253853..4254629 | + | 777 | WP_003411137.1 | YggS family pyridoxal phosphate-dependent enzyme | - |
| MR177_RS19830 | 4254695..4255351 | + | 657 | WP_003411133.1 | cell division protein SepF | - |
| MR177_RS19835 | 4255513..4255803 | + | 291 | WP_003900476.1 | YggT family protein | - |
| MR177_RS19840 | 4256071..4256853 | + | 783 | WP_242302820.1 | cell wall synthesis protein Wag31 | - |
| MR177_RS19845 | 4256948..4257304 | + | 357 | WP_003411130.1 | hypothetical protein | - |
| MR177_RS19850 | 4257434..4258492 | - | 1059 | WP_003411129.1 | phosphoribosyltransferase family protein | - |
| MR177_RS19855 | 4258747..4258962 | + | 216 | WP_003411127.1 | antitoxin ParD2 | Antitoxin |
| MR177_RS19860 | 4258959..4259276 | + | 318 | WP_003411124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MR177_RS19870 | 4259689..4261035 | + | 1347 | WP_242302821.1 | M20/M25/M40 family metallo-hydrolase | - |
| MR177_RS19875 | 4261083..4261613 | + | 531 | WP_003904790.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| MR177_RS19880 | 4261618..4262691 | - | 1074 | WP_003411116.1 | quinone-dependent dihydroorotate dehydrogenase | - |
| MR177_RS19885 | 4262727..4263008 | - | 282 | WP_003411112.1 | DUF5703 family protein | - |
| MR177_RS19890 | 4263005..4264081 | - | 1077 | WP_003904789.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12312.88 Da Isoelectric Point: 6.4831
>T295316 WP_003411124.1 NZ_OW052570:4258959-4259276 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FAJ4 |