Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3852460..3853112 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPX1 |
| Locus tag | MR177_RS17955 | Protein ID | WP_003412752.1 |
| Coordinates | 3852460..3852885 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ24 |
| Locus tag | MR177_RS17960 | Protein ID | WP_003412749.1 |
| Coordinates | 3852891..3853112 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS17930 | 3847465..3848022 | + | 558 | WP_003412768.1 | MaoC family dehydratase | - |
| MR177_RS17935 | 3848019..3848840 | + | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
| MR177_RS17940 | 3849099..3850202 | + | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
| MR177_RS17945 | 3850213..3851259 | + | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
| MR177_RS17950 | 3851256..3852437 | + | 1182 | WP_003899351.1 | dihydrolipoamide acetyltransferase family protein | - |
| MR177_RS17955 | 3852460..3852885 | - | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR177_RS17960 | 3852891..3853112 | - | 222 | WP_003412749.1 | antitoxin | Antitoxin |
| MR177_RS17965 | 3853165..3853917 | - | 753 | WP_003901416.1 | hypothetical protein | - |
| MR177_RS17970 | 3853907..3854530 | - | 624 | WP_003900858.1 | TIGR00725 family protein | - |
| MR177_RS17975 | 3854666..3854872 | + | 207 | WP_003899347.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T295315 WP_003412752.1 NZ_OW052570:c3852885-3852460 [Mycobacterium tuberculosis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TPX1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BW03 |