Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3806288..3806928 Replicon chromosome
Accession NZ_OW052570
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag MR177_RS17760 Protein ID WP_003412970.1
Coordinates 3806509..3806928 (+) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag MR177_RS17755 Protein ID WP_003412975.1
Coordinates 3806288..3806512 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR177_RS17735 3801905..3802468 + 564 WP_031657453.1 elongation factor P -
MR177_RS17740 3802471..3802941 + 471 WP_003412985.1 transcription antitermination factor NusB -
MR177_RS17745 3802941..3803342 + 402 WP_003412981.1 hypothetical protein -
MR177_RS17750 3803414..3806257 + 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
MR177_RS17755 3806288..3806512 + 225 WP_003412975.1 antitoxin VapB39 Antitoxin
MR177_RS17760 3806509..3806928 + 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
MR177_RS17765 3806929..3807879 - 951 WP_003911916.1 ERCC4 domain-containing protein -
MR177_RS17770 3807977..3808183 + 207 WP_229298035.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
MR177_RS17775 3808524..3809444 + 921 WP_242302807.1 restriction endonuclease -
MR177_RS17780 3809479..3809880 - 402 WP_003412963.1 PIN domain-containing protein -
MR177_RS17785 3809877..3810104 - 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
MR177_RS17790 3810621..3811343 + 723 WP_003412957.1 DUF1906 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T295314 WP_003412970.1 NZ_OW052570:3806509-3806928 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT295314 WP_003412975.1 NZ_OW052570:3806288-3806512 [Mycobacterium tuberculosis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References