Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3791302..3791933 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ28 |
Locus tag | MR177_RS17660 | Protein ID | WP_003413174.1 |
Coordinates | 3791302..3791679 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P95006 |
Locus tag | MR177_RS17665 | Protein ID | WP_003413167.1 |
Coordinates | 3791676..3791933 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS17625 | 3786769..3787281 | + | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
MR177_RS17630 | 3787274..3788527 | + | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
MR177_RS17635 | 3788524..3789333 | + | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
MR177_RS17640 | 3789345..3789764 | + | 420 | WP_003413190.1 | A24 family peptidase | - |
MR177_RS17645 | 3790175..3790420 | + | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
MR177_RS17650 | 3790417..3790812 | + | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
MR177_RS17655 | 3790912..3791286 | + | 375 | WP_003413177.1 | hypothetical protein | - |
MR177_RS17660 | 3791302..3791679 | - | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR177_RS17665 | 3791676..3791933 | - | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
MR177_RS17670 | 3791972..3792385 | - | 414 | WP_003413164.1 | PIN domain nuclease | - |
MR177_RS17675 | 3792478..3792756 | - | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MR177_RS17680 | 3792753..3793415 | - | 663 | WP_003900848.1 | LppA family lipoprotein | - |
MR177_RS17685 | 3793412..3794071 | - | 660 | WP_003900847.1 | LppA family lipoprotein | - |
MR177_RS17690 | 3794068..3794727 | - | 660 | WP_003900846.1 | LppA family lipoprotein | - |
MR177_RS17695 | 3794854..3796065 | - | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
MR177_RS17700 | 3796361..3796675 | - | 315 | WP_009937839.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13728.72 Da Isoelectric Point: 4.4687
>T295312 WP_003413174.1 NZ_OW052570:c3791679-3791302 [Mycobacterium tuberculosis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ28 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C9W5 |