Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3729747..3730461 Replicon chromosome
Accession NZ_OW052570
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag MR177_RS17385 Protein ID WP_003413460.1
Coordinates 3729747..3730187 (-) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag MR177_RS17390 Protein ID WP_003413456.1
Coordinates 3730174..3730461 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR177_RS17360 3725659..3726333 - 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -
MR177_RS17365 3726461..3727360 + 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
MR177_RS17370 3727389..3728234 + 846 WP_003413466.1 acyl-CoA thioesterase II -
MR177_RS17375 3728242..3728838 + 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
MR177_RS17380 3728971..3729726 + 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
MR177_RS17385 3729747..3730187 - 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
MR177_RS17390 3730174..3730461 - 288 WP_003413456.1 antitoxin VapB41 Antitoxin
MR177_RS17395 3730572..3732143 - 1572 WP_003899392.1 polyamine aminopropyltransferase -
MR177_RS17400 3732140..3732598 - 459 WP_003413451.1 DUF350 domain-containing protein -
MR177_RS17405 3732623..3733054 - 432 WP_003413445.1 DUF4247 domain-containing protein -
MR177_RS17410 3733051..3733545 - 495 WP_003413444.1 DUF2617 family protein -
MR177_RS17415 3733556..3734176 - 621 WP_003413441.1 DUF4178 domain-containing protein -
MR177_RS17420 3734393..3734797 - 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
MR177_RS17425 3734794..3735039 - 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T295310 WP_003413460.1 NZ_OW052570:c3730187-3729747 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT295310 WP_003413456.1 NZ_OW052570:c3730461-3730174 [Mycobacterium tuberculosis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References