Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3600282..3600969 Replicon chromosome
Accession NZ_OW052570
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag MR177_RS16620 Protein ID WP_003414064.1
Coordinates 3600282..3600677 (+) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag MR177_RS16625 Protein ID WP_003414061.1
Coordinates 3600703..3600969 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR177_RS16585 3596179..3596916 - 738 WP_003414079.1 dienelactone hydrolase family protein -
MR177_RS16590 3597072..3597872 + 801 WP_003911953.1 thymidylate synthase -
MR177_RS16595 3597943..3598422 + 480 WP_003414073.1 dihydrofolate reductase -
MR177_RS16600 3598423..3598497 - 75 Protein_3281 hypothetical protein -
MR177_RS16605 3598496..3598915 + 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
MR177_RS16610 3598912..3600006 + 1095 WP_242302796.1 restriction endonuclease subunit S -
MR177_RS16615 3600016..3600285 + 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
MR177_RS16620 3600282..3600677 + 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
MR177_RS16625 3600703..3600969 + 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR177_RS16630 3600966..3601382 + 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
MR177_RS16635 3601469..3603091 + 1623 WP_242302797.1 class I SAM-dependent DNA methyltransferase -
MR177_RS16640 3603088..3603363 + 276 WP_003414055.1 type I restriction endonuclease subunit S -
MR177_RS16650 3603607..3604359 + 753 WP_031657460.1 FAD-dependent thymidylate synthase -
MR177_RS16655 3604428..3605330 + 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T295308 WP_003414064.1 NZ_OW052570:3600282-3600677 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT295308 WP_003414061.1 NZ_OW052570:3600703-3600969 [Mycobacterium tuberculosis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References