Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3600282..3600969 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TF65 |
| Locus tag | MR177_RS16620 | Protein ID | WP_003414064.1 |
| Coordinates | 3600282..3600677 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TF64 |
| Locus tag | MR177_RS16625 | Protein ID | WP_003414061.1 |
| Coordinates | 3600703..3600969 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS16585 | 3596179..3596916 | - | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
| MR177_RS16590 | 3597072..3597872 | + | 801 | WP_003911953.1 | thymidylate synthase | - |
| MR177_RS16595 | 3597943..3598422 | + | 480 | WP_003414073.1 | dihydrofolate reductase | - |
| MR177_RS16600 | 3598423..3598497 | - | 75 | Protein_3281 | hypothetical protein | - |
| MR177_RS16605 | 3598496..3598915 | + | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
| MR177_RS16610 | 3598912..3600006 | + | 1095 | WP_242302796.1 | restriction endonuclease subunit S | - |
| MR177_RS16615 | 3600016..3600285 | + | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| MR177_RS16620 | 3600282..3600677 | + | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR177_RS16625 | 3600703..3600969 | + | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MR177_RS16630 | 3600966..3601382 | + | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
| MR177_RS16635 | 3601469..3603091 | + | 1623 | WP_242302797.1 | class I SAM-dependent DNA methyltransferase | - |
| MR177_RS16640 | 3603088..3603363 | + | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
| MR177_RS16650 | 3603607..3604359 | + | 753 | WP_031657460.1 | FAD-dependent thymidylate synthase | - |
| MR177_RS16655 | 3604428..3605330 | + | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T295308 WP_003414064.1 NZ_OW052570:3600282-3600677 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|