Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3560815..3561385 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | MR177_RS16400 | Protein ID | WP_003414166.1 |
Coordinates | 3561029..3561385 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | MR177_RS16395 | Protein ID | WP_003901465.1 |
Coordinates | 3560815..3561045 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS16355 | 3555833..3556144 | - | 312 | WP_003414190.1 | hypothetical protein | - |
MR177_RS16360 | 3556249..3556506 | - | 258 | WP_003899489.1 | hypothetical protein | - |
MR177_RS16365 | 3557616..3557876 | - | 261 | Protein_3234 | transposase | - |
MR177_RS16370 | 3558093..3558284 | - | 192 | WP_003414184.1 | hypothetical protein | - |
MR177_RS16375 | 3558281..3558685 | - | 405 | WP_003414181.1 | hypothetical protein | - |
MR177_RS16380 | 3558833..3559087 | + | 255 | WP_003917684.1 | hypothetical protein | - |
MR177_RS16385 | 3559263..3559730 | - | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
MR177_RS16390 | 3559729..3560772 | + | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
MR177_RS16395 | 3560815..3561045 | + | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
MR177_RS16400 | 3561029..3561385 | + | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
MR177_RS16405 | 3561487..3563136 | - | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
MR177_RS16410 | 3563155..3563742 | - | 588 | WP_003914429.1 | DUF3558 family protein | - |
MR177_RS16415 | 3563915..3564241 | + | 327 | WP_003414157.1 | hypothetical protein | - |
MR177_RS16420 | 3564245..3565933 | + | 1689 | WP_242302795.1 | alpha/beta hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T295307 WP_003414166.1 NZ_OW052570:3561029-3561385 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|