295305

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3532964..3533568 Replicon chromosome
Accession NZ_OW052570
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag MR177_RS16255 Protein ID WP_003414492.1
Coordinates 3533176..3533568 (+) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag MR177_RS16250 Protein ID WP_003414495.1
Coordinates 3532964..3533179 (+) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR177_RS16225 3527966..3528877 + 912 WP_003414505.1 sugar ABC transporter permease -
MR177_RS16230 3528874..3529701 + 828 WP_003414504.1 carbohydrate ABC transporter permease -
MR177_RS16235 3529704..3531014 + 1311 WP_003414501.1 ABC transporter substrate-binding protein -
MR177_RS16240 3531007..3532089 + 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
MR177_RS16245 3532168..3532917 - 750 WP_003414497.1 enoyl-CoA hydratase -
MR177_RS16250 3532964..3533179 + 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
MR177_RS16255 3533176..3533568 + 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
MR177_RS16260 3533589..3533858 + 270 WP_003912856.1 DUF2277 family protein -
MR177_RS16265 3533855..3534400 + 546 WP_242302794.1 DUF1802 family protein -
MR177_RS16270 3534705..3535592 + 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
MR177_RS16275 3535595..3536479 + 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
MR177_RS16280 3536751..3537296 + 546 WP_003904931.1 DUF1802 family protein -
MR177_RS16285 3537630..3538418 + 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T295305 WP_003414492.1 NZ_OW052570:3533176-3533568 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT295305 WP_003414495.1 NZ_OW052570:3532964-3533179 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References