Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN_Sll0205-like-Phd |
| Location | 3532964..3533568 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P71623 |
| Locus tag | MR177_RS16255 | Protein ID | WP_003414492.1 |
| Coordinates | 3533176..3533568 (+) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A829CBY8 |
| Locus tag | MR177_RS16250 | Protein ID | WP_003414495.1 |
| Coordinates | 3532964..3533179 (+) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS16225 | 3527966..3528877 | + | 912 | WP_003414505.1 | sugar ABC transporter permease | - |
| MR177_RS16230 | 3528874..3529701 | + | 828 | WP_003414504.1 | carbohydrate ABC transporter permease | - |
| MR177_RS16235 | 3529704..3531014 | + | 1311 | WP_003414501.1 | ABC transporter substrate-binding protein | - |
| MR177_RS16240 | 3531007..3532089 | + | 1083 | WP_003414499.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| MR177_RS16245 | 3532168..3532917 | - | 750 | WP_003414497.1 | enoyl-CoA hydratase | - |
| MR177_RS16250 | 3532964..3533179 | + | 216 | WP_003414495.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MR177_RS16255 | 3533176..3533568 | + | 393 | WP_003414492.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR177_RS16260 | 3533589..3533858 | + | 270 | WP_003912856.1 | DUF2277 family protein | - |
| MR177_RS16265 | 3533855..3534400 | + | 546 | WP_242302794.1 | DUF1802 family protein | - |
| MR177_RS16270 | 3534705..3535592 | + | 888 | WP_003414414.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| MR177_RS16275 | 3535595..3536479 | + | 885 | WP_003414409.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MR177_RS16280 | 3536751..3537296 | + | 546 | WP_003904931.1 | DUF1802 family protein | - |
| MR177_RS16285 | 3537630..3538418 | + | 789 | WP_003917092.1 | CRISPR-associated endoribonuclease Cas6 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14610.74 Da Isoelectric Point: 6.7594
>T295305 WP_003414492.1 NZ_OW052570:3533176-3533568 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BWM8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CBY8 |