Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3486363..3487059 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | MR177_RS16030 | Protein ID | WP_003414624.1 |
Coordinates | 3486363..3486806 (-) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MR177_RS16035 | Protein ID | WP_193566358.1 |
Coordinates | 3486793..3487059 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS16005 | 3482211..3482477 | - | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
MR177_RS16010 | 3482577..3483158 | - | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
MR177_RS16015 | 3483254..3485002 | - | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
MR177_RS16020 | 3485334..3485525 | - | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
MR177_RS16025 | 3485621..3486283 | - | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
MR177_RS16030 | 3486363..3486806 | - | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR177_RS16035 | 3486793..3487059 | - | 267 | WP_193566358.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
MR177_RS16040 | 3487177..3488418 | + | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
MR177_RS16045 | 3488426..3489640 | + | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
MR177_RS16050 | 3489657..3490820 | + | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
MR177_RS16055 | 3490876..3491730 | + | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T295303 WP_003414624.1 NZ_OW052570:c3486806-3486363 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|