Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 2870557..2871224 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O50411 |
Locus tag | MR177_RS13330 | Protein ID | WP_003417916.1 |
Coordinates | 2870832..2871224 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
Locus tag | MR177_RS13325 | Protein ID | WP_003912214.1 |
Coordinates | 2870557..2870832 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS13310 | 2865601..2866473 | + | 873 | WP_003417929.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
MR177_RS13315 | 2866544..2868814 | - | 2271 | WP_031653948.1 | PE family protein | - |
MR177_RS13320 | 2869004..2870375 | - | 1372 | Protein_2629 | ISNCY family transposase | - |
MR177_RS13325 | 2870557..2870832 | + | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MR177_RS13330 | 2870832..2871224 | + | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR177_RS13335 | 2871978..2873030 | + | 1053 | WP_003900678.1 | polyprenyl synthetase family protein | - |
MR177_RS13340 | 2873030..2874019 | + | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
MR177_RS13345 | 2874016..2875854 | + | 1839 | WP_019830554.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2869004..2869681 | 677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T295299 WP_003417916.1 NZ_OW052570:2870832-2871224 [Mycobacterium tuberculosis]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BXS8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E8U8S7 |