Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
Location | 1889724..1890250 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | Rv0299 | Uniprot ID | - |
Locus tag | MR177_RS08915 | Protein ID | WP_003401560.1 |
Coordinates | 1889724..1890026 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | Rv0298 | Uniprot ID | P9WJ08 |
Locus tag | MR177_RS08920 | Protein ID | WP_003401555.1 |
Coordinates | 1890023..1890250 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS08895 | 1887360..1888268 | - | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
MR177_RS08900 | 1888265..1888897 | - | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
MR177_RS08905 | 1889033..1889458 | - | 426 | WP_003401566.1 | PIN domain nuclease | - |
MR177_RS08910 | 1889455..1889676 | - | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | - |
MR177_RS08915 | 1889724..1890026 | - | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
MR177_RS08920 | 1890023..1890250 | - | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MR177_RS08925 | 1890393..1892213 | - | 1821 | WP_031653699.1 | PE family protein | - |
MR177_RS08930 | 1892392..1893789 | + | 1398 | WP_003401544.1 | sulfatase | - |
MR177_RS08935 | 1893799..1894602 | + | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T295296 WP_003401560.1 NZ_OW052570:c1890026-1889724 [Mycobacterium tuberculosis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|