295289

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 1554896..1555542 Replicon chromosome
Accession NZ_OW052570
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag MR177_RS07380 Protein ID WP_003403137.1
Coordinates 1555129..1555542 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag MR177_RS07375 Protein ID WP_003403139.1
Coordinates 1554896..1555132 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR177_RS07340 1549970..1550680 - 711 Protein_1446 IS607 family element RNA-guided endonuclease TnpB -
MR177_RS07345 1550682..1551266 - 585 WP_003403171.1 IS607-like element IS1536 family transposase -
MR177_RS07350 1551507..1552457 - 951 WP_003907436.1 DUF1259 domain-containing protein -
MR177_RS07355 1552529..1552840 - 312 WP_003403164.1 hypothetical protein -
MR177_RS07360 1552963..1553658 + 696 WP_200861092.1 two-component system response regulator TcrA -
MR177_RS07365 1553642..1554172 + 531 WP_003917320.1 two component system sensor kinase HK2 -
MR177_RS07370 1554286..1554792 + 507 WP_003900973.1 two component system sensor kinase HK1 -
MR177_RS07375 1554896..1555132 + 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
MR177_RS07380 1555129..1555542 + 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
MR177_RS07385 1555793..1557028 + 1236 WP_003403128.1 ATP-binding protein -
MR177_RS07390 1557211..1557468 + 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
MR177_RS07395 1557465..1557857 + 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
MR177_RS07400 1557909..1559459 - 1551 WP_003403119.1 MlaD family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T295289 WP_003403137.1 NZ_OW052570:1555129-1555542 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT295289 WP_003403139.1 NZ_OW052570:1554896-1555132 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References