Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1548809..1549452 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67239 |
Locus tag | MR177_RS07325 | Protein ID | WP_003403187.1 |
Coordinates | 1548809..1549210 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ91 |
Locus tag | MR177_RS07330 | Protein ID | WP_003403184.1 |
Coordinates | 1549207..1549452 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS07300 | 1545767..1546372 | - | 606 | WP_003898526.1 | hypothetical protein | - |
MR177_RS07305 | 1546514..1546735 | + | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
MR177_RS07310 | 1546787..1547944 | + | 1158 | Protein_1440 | hypothetical protein | - |
MR177_RS07315 | 1548024..1548221 | + | 198 | WP_003403191.1 | hypothetical protein | - |
MR177_RS07320 | 1548639..1548818 | - | 180 | Protein_1442 | hypothetical protein | - |
MR177_RS07325 | 1548809..1549210 | - | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR177_RS07330 | 1549207..1549452 | - | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR177_RS07335 | 1549497..1549967 | - | 471 | WP_003898523.1 | hypothetical protein | - |
MR177_RS07340 | 1549970..1550680 | - | 711 | Protein_1446 | IS607 family element RNA-guided endonuclease TnpB | - |
MR177_RS07345 | 1550682..1551266 | - | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
MR177_RS07350 | 1551507..1552457 | - | 951 | WP_003907436.1 | DUF1259 domain-containing protein | - |
MR177_RS07355 | 1552529..1552840 | - | 312 | WP_003403164.1 | hypothetical protein | - |
MR177_RS07360 | 1552963..1553658 | + | 696 | WP_200861092.1 | two-component system response regulator TcrA | - |
MR177_RS07365 | 1553642..1554172 | + | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T295288 WP_003403187.1 NZ_OW052570:c1549210-1548809 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ91 |