Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1541289..1541914 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | MR177_RS07275 | Protein ID | WP_003403218.1 |
| Coordinates | 1541289..1541690 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | MR177_RS07280 | Protein ID | WP_003403213.1 |
| Coordinates | 1541687..1541914 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS07250 | 1536378..1537325 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| MR177_RS07255 | 1537336..1538493 | - | 1158 | WP_003903091.1 | hypothetical protein | - |
| MR177_RS07260 | 1538888..1539979 | - | 1092 | WP_003900977.1 | galactokinase | - |
| MR177_RS07265 | 1539976..1541058 | - | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
| MR177_RS07270 | 1541077..1541160 | - | 84 | Protein_1432 | galactose-1-phosphate uridylyltransferase | - |
| MR177_RS07275 | 1541289..1541690 | - | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| MR177_RS07280 | 1541687..1541914 | - | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| MR177_RS07285 | 1542109..1542351 | - | 243 | WP_003403210.1 | hypothetical protein | - |
| MR177_RS07290 | 1542348..1543097 | - | 750 | WP_003898528.1 | hypothetical protein | - |
| MR177_RS07295 | 1543181..1545748 | + | 2568 | WP_003900188.1 | SEC-C metal-binding domain-containing protein | - |
| MR177_RS07300 | 1545767..1546372 | - | 606 | WP_003898526.1 | hypothetical protein | - |
| MR177_RS07305 | 1546514..1546735 | + | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T295287 WP_003403218.1 NZ_OW052570:c1541690-1541289 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |